Skip to content
FashionFrom Gucci To Balenciaga: 15 Designer Kids' Collections For Your Mini-Me

From Gucci To Balenciaga: 15 Designer Kids' Collections For Your Mini-Me

From Gucci To Balenciaga: 15 Designer Kids' Collections For Your Mini-Me
By Aina Izzah
August 23, 2019
You're never too young to make a style statement, especially with these designer collections that put an edgy twist to "dressing your age"
Image: Gucci Kids
Image: Gucci Kids
Image: Gucci Kids
Image: Gucci Kids

1/15Gucci Kids

The chances of your mini-me outshining you are high with Gucci Kids' Fall/Winter 2019 collection. If you don't mind that at all then indulge in tweed, silk, and iconic Gucci footwear and accessories for your kid.

Available at Gucci Children

Image: Baby Dior
Image: Baby Dior

2/15Baby Dior

Baby Dior has always been synonymous with royalty and this is something that the luxury brand's creative director Cordelia de Castellane doesn't let anyone forget. This season, she adds a modern touch to the Fall/Winter 2019 looks by featuring an enlarged version of the Dior Oblique motif on ready-to-wear apparel including cotton jersey T-shirts and fleece sweatshirts.

Available at Dior Kids


Image: Burberry Children
Image: Burberry Children
Image: Burberry Children
Image: Burberry Children

3/15Burberry Children

The British luxury label has made it extremely easy for stylish parents to be fashionably in sync with their tiny tots thanks to the new kid's additions. Among the standout pieces are the brand's classic trench coats updated with the runway Horseferry print.

Available at Burberry Children

See also: A Home Designed To Be Passed From You To Your Children

Image: Fendi Kids
Image: Fendi Kids
Image: Fendi Kids
Image: Fendi Kids

4/15Fendi Kids

The iconic Fendi logo makes its way into the kidswear scene with fully monogrammed leggings and coats. Fun prints featuring Fendi Bug Eyes can also be spotted on jackets and waist pouches. 

Available at Fendi Kids

Image: Polo Ralph Lauren Kids
Image: Polo Ralph Lauren Kids

5/15Polo Ralph Lauren Kids

This designer label is the epitome of timeless, classic American style. The brand's iconic embroidered pony appears on several pieces of their kidswear line such as knit sweaters, rompers, button-down shirts and more. 

Available at Ralph Lauren Kids

Image: Balenciaga Kids
Image: Balenciaga Kids

6/15Balenciaga Kids

Street style is still having a moment and there is no fashion house better to dress your kids in this movement than Balenciaga. Choose from hoodies with the brand's quintessential Bernie Sanders-inspired campaign logo splashed across the back to trendy Speed Trainers. The best part? Your young ones wouldn't have to forgo comfort for style. 

Available at Balenciaga Kids

Image: Stella McCartney Kids
Image: Stella McCartney Kids

7/15Stella McCartney Kids

Look out for bright and colourful motifs, metallic faux leather and cute slogans in Stella McCartney's Fall/Winter 2019 children's collection. The brand clearly made sure to keep rainbow and multi-colour hues in mind when designing these fun pieces—including a shoulder bag in the shape of a rocket. 

Available at Stella McCartney Kids

See also: Finest Dog Breeds For Family, Protection And Young Professionals

Image: Dolce & Gabbana
Image: Dolce & Gabbana
Image: Dolce & Gabbana
Image: Dolce & Gabbana

8/15Dolce & Gabbana Children

Early signs of Christmas are already spotted in Dolce & Gabbana's Fall/Winter 2019 collection. Dresses and shoes with poinsettia prints are heavily featured this season, along with festive-ready frocks and eye-catching tracksuits.

Available atDolce & Gabbana Children

Image: Young Versace
Image: Young Versace
Image: Young Versace
Image: Young Versace

9/15Young Versace

Let your little tyke steal the show with Young Versace's Fall/Winter 2019 collection, which stays true to the label's DNA with vivacious and bold pieces. The designer's signature Barocco print is featured heavily across the collection as seen on sweaters and shirts. 

Available at Young Versace

Photo credit: Junior Lookbook
Photo credit: Junior Lookbook
Photo credit: Junior Lookbook

10/15Givenchy Kids

Bold and sophisticated—the appeal of this collection lies in the interpretation of its design by Givenchy's artistic director Clare Waight Keller, and past couture collections by Hubert de Givenchy. The result is an impressive range for the little ones comprising polo shirts, fairy-tale printed shirts and pleated dresses.

Available at Givenchy Kids

Photo credit: Balmain Kids.
Image: Balmain Kids

11/15Balmain Kids

Effortlessly cool and chic, the French brand has dressed some of the most famous (and luckiest!) kids in the world including North West and Blue Ivy. Never putting a glass ceiling over childrenswear, their designs are outstanding. Case in point: the futuristic neon pieces from Balmain Kids' Spring/Summer 2019 collection.

Available at Balmain Kids

Photo credit: Lanvin Children's Universe.
Image: Lanvin Children's Universe

12/15Lanvin Children's Universe

Step right up for fresh summer vibes with Lanvin's latest ready-to-wear collection from their kids' line, Children’s Universe. Make a statement with the subtle prints of a dinosaur-inspired bowling shirt or an embroidered jacquard dress. 

Available at Lanvin Children



Image: Kenzo
Image: Kenzo
Image: Kenzo
Image: Kenzo

13/15Kenzo Kids

Expect designs that range from fun patterns and zesty prints to pastels in Kenzo Kid's Fall/Winter 2019 collection. This season, dragons and Japanese flower motifs take the spotlight, decorated on varsity jackets and T-shirts. The Kenzo Tiger is, of course, prevalent throughout the collection. 

Available at Kenzo Kids

Image: Emporio Armani Junior
Image: Emporio Armani Junior

14/15Emporio Armani Junior

The Italian luxury fashion house's junior collection sees achromatic hues of black and white for Fall/Winter 2019. This culminated in stylish, sleek pieces that are sure to make your tiny tots mini fashionistas.

Available at Emporio Armani Junior

Photo credit: Paul Smith Junior
Image: Paul Smith Junior

15/15Paul Smith Junior

Roaring its way into our hearts are the ever-charming designs of Paul Smith Junior’s Dino collection that makes Jurassic beasts the star. A simple T-shirt can never go wrong for a Mesozoic era-themed birthday party.

Available at Paul Smith Junior

See also: Thailand Tatler Talks To 5 Mother & Son Duos


Fashionkidswearchildrenfamilystylechildren's fashionguccibalenciaga


In order to provide you with the best possible experience, this website uses cookies. For more information, please refer to our Privacy Policy.
